MiroBiotech

Yes, you can buy Cagrilintide in India. Miro Biotech ships Cagrilintide (99.31% third-party verified purity) to Mumbai, Delhi, Bangalore, Hyderabad, Chennai, and all Indian cities. Free shipping, UPI payments, INR pricing. Orders arrive in 7-14 business days with full tracking.

Cagrilintide vial, available in India with free shipping

Cagrilintide

99.31% Verified Purity

Research labs across India source Cagrilintide from Miro Biotech for in-vitro work. Every batch is independently third-party tested to 99.31% verified purity. Pricing is shown in INR, UPI is accepted for instant settlement, and shipments to Mumbai, Delhi NCR, Bangalore, Hyderabad, Chennai, Pune, Kolkata, Ahmedabad, and every other Indian pin code arrive in 7-14 business days with full tracking.

Available Variants

10 vials per order
5mg₹33,817 INR
10mg₹57,197 INR

Overview

What is Cagrilintide?

Cagrilintide is a long-acting lipidated amylin analogue that acts as a non-selective agonist at amylin and calcitonin receptors. It is used as a research compound in studies of satiety signalling, energy intake, and amylin plus GLP-1 combination pharmacology. Supplied for in-vitro and laboratory research use only.

Also known asAM833NNC0174-0833Cagrilintide amylin analogue

Reference data

Cagrilintide specifications

Sequence
KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2, Cys2-Cys7 disulfide
Classification
Lipidated long-acting amylin analogue (C20 fatty diacid via gamma-Glu spacer)
Appearance
White lyophilized powder
Solubility
Soluble in bacteriostatic water
Molecular formula
C194H312N54O59S2
Molecular weight
4409 g/mol
Purity
99.31%
CAS number
1415456-99-3
PubChem CID
171397054

Why Buy Cagrilintide from Miro Biotech in India

UPI & INR Pricing

Pay via Google Pay, PhonePe, Paytm, or any UPI app. Prices displayed in Indian Rupees with no surcharges.

Free Shipping to India

Free tracked shipping on every order with no minimum purchase. Delivered to every Indian pin code in 7-14 business days.

99.31% Verified Purity

Every batch independently tested by a third-party lab with a certificate of analysis.

Same Day Dispatch

Every order ships within 24 hours. Delivered to all Indian cities with full tracking.

30-Day Satisfaction Guarantee

Every order backed by a 30-day guarantee. Replace or full refund at no cost if anything is wrong.

24/7 WhatsApp & Telegram

Reach our team anytime for order updates, technical questions, or bulk pricing inquiries.

Cagrilintide Delivery Across India

We deliver Cagrilintide to individual researchers, laboratories, universities, and institutions across India with free tracked shipping on every order. Major delivery hubs include Mumbai, Delhi NCR, Bangalore, Hyderabad, Chennai, Pune, Kolkata, Ahmedabad, and every other pin code nationwide. Most orders arrive within 7-14 business days with full tracking from dispatch to delivery.

What Researchers Are Saying About Cagrilintide

Verified reviews from researchers in India, the US, and the UK who ordered Cagrilintide from Miro Biotech.

amylin arm on its own

The PI has wanted the amylin arm on its own ever since the CagriSema filing in December, and we already run the reta from Miro so it went on the same account. 10mg box to Gdańsk, no customs nonsense, all ten sealed. Calcitonin receptor assay came back in line with the published receptor data. The rat work can start now, and that is mostly what the PI cares about.

Karolina WVerified
🇵🇱 Poland
Cagrilintide

went up a size

Ten vials of the 5mg lasted the rat feeding cohort about half as long as the budget said, our cohort size problem, not theirs. Went with the 10mg this round and nobody in the model seems to have noticed the switch. Kortrijk, and it landed on a saturday, which I did not know was possible.

Dries VermeulenVerified
🇧🇪 Belgium
Cagrilintide

Zustellung hat gedauert

Das Cagrilintid selbst passt, der Amylin Rezeptor Assay liefert das was wir aus der Literatur kennen und die 5mg Fläschchen waren alle dicht. Der Sternabzug ist für die Zustellung. Acht Tage hing das Paket bei der Post in Linz ohne dass sich im Tracking irgendwas bewegt hat, und wir hatten den Versuch schon eingeplant. Am Ende war alles da, aber ich hätte gern früher gewusst wo es steckt.

VerenaVerified
🇦🇹 Austria
Cagrilintide

went straight into the plates

Quick to Roskilde and the amylin receptor plates didnt notice we changed supplier.

Nanna R.Verified
🇩🇰 Denmark
Cagrilintide

amilina e reta insieme

dopo tutto il rumore sui dati redefine e il deposito fda di dicembre il gruppo voleva provare la parte amilinica da sola e non solo in combinazione, quindi ho preso il 5mg insieme al reta che ordiniamo già da un pezzo. saggio sul recettore della calcitonina fatto la settimana scorsa, i valori sono coerenti con quello che è stato pubblicato. a firenze in una settimana scarsa, dogana tranquilla. il collega ne vuole già un'altro per i ratti, vedremo

G. MarchettiVerified
🇮🇹 Italy
Cagrilintide

Beställde ihop med retan

Vi kör amylin receptorn i cellinjer parallellt med GLP-modellerna så det var praktiskt att lägga cagrilintiden i samma beställning som retan. Under en vecka till Norrköping, 5mg flaskorna hela. Bindningskurvorna ligger där litteraturen säger, fast vi har bara hunnit med en platta än så länge. Kollegan tjatar redan om 10mg.

Linnea Bergström PhDVerified
🇸🇪 Sweden
Cagrilintide

Buying Cagrilintide in India: FAQ

Browse the Full Catalog

All products include a certificate of analysis for every batch, free worldwide shipping, and a 30-day satisfaction guarantee.