- Free worldwide shipping, tracked and insured
- Same day dispatch, customs handled
- Certificate of analysis for every batch
- Amylin receptor pharmacology research
- Calcitonin receptor agonism studies
- Energy-intake and satiety pathway models
Overview
What is Cagrilintide?
Cagrilintide is a long-acting lipidated amylin analogue that acts as a non-selective agonist at amylin and calcitonin receptors. It is used as a research compound in studies of satiety signalling, energy intake, and amylin plus GLP-1 combination pharmacology. Supplied for in-vitro and laboratory research use only.
Mechanism in research
How Cagrilintide is studied
In published research, cagrilintide was characterised as a non-selective agonist of the amylin receptors (calcitonin receptor with receptor activity-modifying proteins) and the calcitonin receptor itself, compared against selective and non-selective reference agonists. Its C20 fatty diacid acylation supports albumin binding and a half-life of roughly 159-195 hours reported in a phase 1b study. A 26-week phase 2 dose-finding trial reported mean body-weight reductions of 6.0-10.8% across once-weekly doses versus 3.0% with placebo, and the phase 3 REDEFINE 1 trial of the cagrilintide plus semaglutide combination reported a -20.4% estimated mean change versus -3.0% for placebo at 68 weeks. These findings describe the published clinical literature; the compound is supplied here strictly as a research reference standard.
Reported targets & pathways
- Amylin receptors (CTR + RAMP1/2/3)
- Calcitonin receptor (CTR)
- Hindbrain and hypothalamic satiety circuits
- Amylin and GLP-1 pathway interaction
Reference data
Cagrilintide specifications
- Sequence
- KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2, Cys2-Cys7 disulfide
- Classification
- Lipidated long-acting amylin analogue (C20 fatty diacid via gamma-Glu spacer)
- Appearance
- White lyophilized powder
- Solubility
- Soluble in bacteriostatic water
- Molecular formula
- C194H312N54O59S2
- Molecular weight
- 4409 g/mol
- Purity
- 99.31%
- CAS number
- 1415456-99-3
- PubChem CID
- 171397054
Research applications
Where Cagrilintide is used in research
Areas of study described in the published literature. Listed for research reference only.
Amylin receptor pharmacology
Used in receptor-signalling assays comparing amylin and calcitonin receptor agonists.
Energy-intake models
Studied in satiety and food-intake research in rodent and human models.
Combination pharmacology
Explored alongside GLP-1 receptor agonists in dual-pathway body-weight research.
Long-acting peptide design
Applied in studies of fatty-diacid acylation, albumin binding, and extended half-life.
Selected research
Published studies on Cagrilintide
Peer-reviewed references for further reading. Findings describe in-vitro and animal research; mechanisms and outcomes in humans are not established.
The Lancet · 2021
Reported a 26-week phase 2 trial in 706 adults where once-weekly cagrilintide 0.3-4.5 mg produced mean body-weight reductions of 6.0-10.8% versus 3.0% with placebo, with gastrointestinal events and injection-site reactions the most frequent adverse events.
The Lancet · 2021
Reported a 20-week phase 1b study in which cagrilintide showed a half-life of 159-195 hours and dose-proportional exposure that did not alter semaglutide exposure, with greater body-weight reductions at 1.2 and 2.4 mg than placebo.
New England Journal of Medicine · 2025
Reported the 68-week phase 3a REDEFINE 1 trial in 3,417 adults, with an estimated mean body-weight change of -20.4% for cagrilintide 2.4 mg plus semaglutide 2.4 mg versus -3.0% for placebo.
Quality
Independently verified, batch by batch
Tested every batch
Every batch of Cagrilintide is independently analyzed by a third-party laboratory before it is released.
Independently verified
Identity and purity are confirmed by an independent third-party laboratory. This batch is verified to 99.31% purity.
Certificate of analysis
Every batch is independently tested with a certificate of analysis. A digital COA is available on request.
Reviews
What researchers say about Cagrilintide
amylin arm on its own
The PI has wanted the amylin arm on its own ever since the CagriSema filing in December, and we already run the reta from Miro so it went on the same account. 10mg box to Gdańsk, no customs nonsense, all ten sealed. Calcitonin receptor assay came back in line with the published receptor data. The rat work can start now, and that is mostly what the PI cares about.
went up a size
Ten vials of the 5mg lasted the rat feeding cohort about half as long as the budget said, our cohort size problem, not theirs. Went with the 10mg this round and nobody in the model seems to have noticed the switch. Kortrijk, and it landed on a saturday, which I did not know was possible.
Zustellung hat gedauert
Das Cagrilintid selbst passt, der Amylin Rezeptor Assay liefert das was wir aus der Literatur kennen und die 5mg Fläschchen waren alle dicht. Der Sternabzug ist für die Zustellung. Acht Tage hing das Paket bei der Post in Linz ohne dass sich im Tracking irgendwas bewegt hat, und wir hatten den Versuch schon eingeplant. Am Ende war alles da, aber ich hätte gern früher gewusst wo es steckt.
went straight into the plates
Quick to Roskilde and the amylin receptor plates didnt notice we changed supplier.
amilina e reta insieme
dopo tutto il rumore sui dati redefine e il deposito fda di dicembre il gruppo voleva provare la parte amilinica da sola e non solo in combinazione, quindi ho preso il 5mg insieme al reta che ordiniamo già da un pezzo. saggio sul recettore della calcitonina fatto la settimana scorsa, i valori sono coerenti con quello che è stato pubblicato. a firenze in una settimana scarsa, dogana tranquilla. il collega ne vuole già un'altro per i ratti, vedremo
Beställde ihop med retan
Vi kör amylin receptorn i cellinjer parallellt med GLP-modellerna så det var praktiskt att lägga cagrilintiden i samma beställning som retan. Under en vecka till Norrköping, 5mg flaskorna hela. Bindningskurvorna ligger där litteraturen säger, fast vi har bara hunnit med en platta än så länge. Kollegan tjatar redan om 10mg.
Cagrilintide FAQ
Related Products
GLP-3 (RT)
99.62% pureTriple agonist peptide targeting GLP-1, GIP, and glucagon receptors for metabolic and obesity research.
Tesamorelin
99.20% pureGHRH analogue that stimulates growth hormone release, researched for metabolic regulation and body composition studies.
MOTS-c
99.79% pureMitochondrial-derived peptide studied for metabolic regulation, insulin sensitivity, and cellular homeostasis.
CJC-1295 (No DAC)
99.60% pureHigh-purity (99.60%) CJC-1295 without DAC research peptide. GHRH analogue for growth hormone secretion, pulsatile GH release, and metabolic pathway studies.
